<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PHPT1527 PHPT1527RT Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y181C   K43E, K122E, D123S, I135IMT, K173L, Q174K, D177E, V179VI, T200A, Q207A, R211S, H221Y, K238R  
>PHPT1527RT| codons 41-240
MEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRLKNPEIIICQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
YQKEPPFLWMGYELHPDRWT

References
Author Title Citation
Ngo-Giang-Huong, N Resistance patterns selected by nevirapine vs. efavirenz in HIV-infected patients failing first-line antiretroviral treatment: A bayesian analysis. PLoS ONE, 2011