<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   V35T, T39K, K43E, S48SL, K122E, D123S, K173L, Q174K, D177E, Q207A, R211S, W212WG, H221HL, K238R L12I
>PHPT1038RT| codons 12-240
IKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKILKIGPENPYNTPVFAIKKKDSTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFT
IPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVICQYMDDLYVGS
DLEIGQHRTKIEELRAHLLSGGFTTPDKKLQKEPPFLWMGYELHPDRWT

References
Author Title Citation
Ngo-Giang-Huong, N Resistance patterns selected by nevirapine vs. efavirenz in HIV-infected patients failing first-line antiretroviral treatment: A bayesian analysis. PLoS ONE, 2011