<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PHPT0889 PHPT0889RT Thailand 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101KE, Y181C   T39K, K43E, K122E, D123S, T139TK, K166R, K173I, Q174K, D177E, I178M, G196A, T200I, Q207A, R211S  
>PHPT0889RT| codons 36-237
EICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLEKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKG
SPAIFQSSMTRILEPFRIKNPEMVICQYVDDLYVGSDLEIAQHRIKIEELRAHLLSWGFT
TPDKKHQKEPPFLWMGYELHPD

References
Author Title Citation
Ngo-Giang-Huong, N Resistance patterns selected by nevirapine vs. efavirenz in HIV-infected patients failing first-line antiretroviral treatment: A bayesian analysis. PLoS ONE, 2011