<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, K173E, D177E, I178M, T200A, E204K, Q207A, R211K, P243T, E297A, L301M, I326IV, G333D, Q334N, T377L, T386I, K390R  
>7225BL| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEKLRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTAEAE
MELAENREILKEPVHGVYYDPSKDLVAEIQKQDNGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIALESIVIWGKIPKFRLPIQKETWEA

References
Author Title Citation
Margot, NA Resistance development over 144 weeks in treatment-naive patients receiving tenofovir disoproxil fumarate or stavudine with lamivudine and efavirenz in Study 903 HIV Med, 2006