<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DT-M15 DT-M15 Vietnam 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, M36I, R41K, K43R, L63C, H69K, L89M, I93L  
>DT-M15| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QICIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   Y181I   K20R, V35T, T39K, K122E, D123S, S162C, K173I, Q174K, D177E, I178V, Q207A, R211S, K238R, V245E  
>DT-M15| codons 12-247
LKPGMDGPRVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPVFAIKKKDSTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFT
IPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEVVIIQYVDDLYVGS
DLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELP

References
Author Title Citation
Lazaro, E Molecular characterization of HIV-1 CRF01_AE in Mekong Delta, Vietnam, and impact of T-cell epitope mutations on HLA recognition (ANRS 12159). PLoS ONE, 2011