<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DT-M1 DT-M1 Vietnam 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43E, K102Q, K122E, D123NS, S162C, F171Y, K173AGRT, Q174K, D177E, I178M, T200TI, Q207A, L210M, R211S, K238R K30KE
>DT-M1| codons 12-244
LKPGMDGPKVKQWPLTEEEIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDESFRKYTAFT
IPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPYRTKNPEMVIYQYMDDLYVGS
DLEIGQHRIKIEELRAHLMSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LV, I13V, G16E, E35D, M36I, R41K, H69K, I72IV, L89M  
>DT-M1| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Lazaro, E Molecular characterization of HIV-1 CRF01_AE in Mekong Delta, Vietnam, and impact of T-cell epitope mutations on HLA recognition (ANRS 12159). PLoS ONE, 2011