<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, G16A, M36I, N37D, R41K, L63F, H69K, L89M, I93L L97P
>TG-M16| codons 1-98
PQITLWQRPLVTVKIAGQLKEALLDTGADDTVFEEIDLPGKWKPKMIGGIGGFIKVRQYD
QIFIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTPN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43E, T69TA, V111VI, K122E, D123NS, S162C, E169D, K173R, Q174K, D177E, I178M, V179I, G196GE, T200TA, Q207A, R211S, F214FL, K238R  
>TG-M16| codons 11-244
KLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSAK
WRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPLDESFRKYTAF
TIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRRKNPEMIIYQYMDDLYVG
SDLEIEQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDRWTVQPI

References
Author Title Citation
Lazaro, E Molecular characterization of HIV-1 CRF01_AE in Mekong Delta, Vietnam, and impact of T-cell epitope mutations on HLA recognition (ANRS 12159). PLoS ONE, 2011