<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TG-M3 TG-M3 Vietnam 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39N, T69N, K122E, D123S, I142V, S162C, F171FY, K173IT, Q174K, D177E, I178M, T200A, Q207S, R211S, K238S, V245E, D256E  
>TG-M3| codons 1-256
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPYRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRSHLLSWGFTTPDKKHQKEPPFLWMGYELHPDSWT
VQPIELPEKDSWTVNE

References
Author Title Citation
Lazaro, E Molecular characterization of HIV-1 CRF01_AE in Mekong Delta, Vietnam, and impact of T-cell epitope mutations on HLA recognition (ANRS 12159). PLoS ONE, 2011