<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16A, E35N, M36I, N37D, R41K, H69K, L89M  
>DN-M3| codons 1-99
PQITLWQRPLVTVKIAGQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    M230MLRW   I2IN, E6D, K11R, V35T, T39K, K43E, K102Q, K122E, D123S, S162C, K173A, Q174K, D177E, T200I, Q207A, R211S, W212WR, W229X, K238R K30KE, K223KEGR, E224AGPR, G231GR
>DN-M3| codons 1-244
PNSPIDTVPVRLKPGMDGPKVKQWPLTEEEIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSRGFTTPDKKHQRRPPFLXWRYELHPDRWT
VQPI

References
Author Title Citation
Lazaro, E Molecular characterization of HIV-1 CRF01_AE in Mekong Delta, Vietnam, and impact of T-cell epitope mutations on HLA recognition (ANRS 12159). PLoS ONE, 2011