<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VT-M2 VT-M2 Vietnam 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F G16E, K20R, M36I, R41K, L63C, H69K, L89M, I93L  
>VT-M2| codons 1-99
PQITLWQRPLVTIKIEGQLREALLDTGADDTVFEEINLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122KE, D123S, S162C, K173I, Q174K, D177E, I178M, Q207A, R211S, K238R  
>VT-M2| codons 12-244
LKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFT
IPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEMVIYQYMDDLYVGS
DLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPI

References
Author Title Citation
Lazaro, E Molecular characterization of HIV-1 CRF01_AE in Mekong Delta, Vietnam, and impact of T-cell epitope mutations on HLA recognition (ANRS 12159). PLoS ONE, 2011