<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE_263 SE_263 Sweden 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13AV, K14R, L19P, K20I, M36I, R41K, L63LP, H69K, V82I, L89M  
>SE_263| codons 1-99
PQITLWQRPLVTVRIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K20R, K32KR, V35T, K102Q, K122E, D123H, I135V, S162A, T165I, K173T, Q174K, D177E, I178M, I195L, T200A, Q207A, V245Q, E248V  
>SE_263| codons 1-253
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIRALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEHFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMIKILEPFRTKNPEMVI
YQYMDDLYVGSDLELGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPVKDSWT

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012