<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13AV, K14R, L19P, K20I, M36I, R41K, L63LP, H69K, V82I, L89M  
>SE_263| codons 1-99
PQITLWQRPLVTVRIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K20R, K32KR, V35T, K102Q, K122E, D123H, I135V, S162A, T165I, K173T, Q174K, D177E, I178M, I195L, T200A, Q207A, V245Q, E248V  
>SE_263| codons 1-253
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIRALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEHFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMIKILEPFRTKNPEMVI
YQYMDDLYVGSDLELGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPVKDSWT

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012