<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE_214 SE_214 Sweden 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, K20KI, E35D, M36I, N37DE, K45KR, L63P, H69K, V82I, L89M, I93V, F99L  
>SE_214| codons 1-99
PQITLWQRPIVTVKVGGQLIEALLDTGADDTVLEDIELPGRWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQVGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11A, V35T, T39K, K43E, D121H, K122E, K173A, Q174K, D177E, T200TA, Q207AT, R211RKNS, K238KR, V245E  
>SE_214| codons 1-253
PISPIDTVPVALKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRTHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWT

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012