<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE_209 SE_209 Sweden 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, G16E, E35N, M36I, N37D, R41K, K43R, I62V, L63Q, I64V, H69Q  
>SE_209| codons 1-99
PQITLWQRPIVTVKVEGQLKEALLDTGADDTVLENIDLPGKWRPKMIGGIGGFIKVRQYD
QVQVEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35I, K49R, V60I, D121Y, K122E, D177E, I178M, K201R, Q207K, R211K, V245K, D250E  
>SE_209| codons 1-253
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALIEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTRIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWT

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012