<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14E, G16E, L19Q, K20R, E35D, M36I, P39PS, K45R, R57K, L63T, H69K, L89M  
>SE_186| codons 1-99
PQITLWQRPIVTVEIEGQQREALLDTGADDTVLEDINLSGRWKPRMIGGIGGFIKVKQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39TILS, E40ED, V60I, D121H, K122E, I135T, S162C, K173S, Q174K, D177E, T200A, Q207A, R211S, V245E, D250E  
>SE_186| codons 1-253
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICSDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWT

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012