<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE_176 SE_176 Sweden 2010 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, E35D, M36I, R41K, L63T, H69Q, I72V, L89M  
>SE_176| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGQKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20R, V35T, T39R, V60I, K122KE, D123N, I142V, K173A, Q174K, D177E, V179I, G196E, T200E, Q207N, R211K, V245H  
>SE_176| codons 1-253
PISPIETVPVTLKPGMDGPRVKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIII
YQYMDDLYVGSDLEIEQHREKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIHLPEKDSWT

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012