<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE_107 SE_107 Sweden 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20KR, L33V, R41K, I64V, I72IV  
>SE_107| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, V35T, V60I, K104R, D121H, K122E, I135T, D177E, I178M, T200I, Q207EG, R211K, V245K, D250E  
>SE_107| codons 1-253
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWT

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012