<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE_105 SE_105 Sweden 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39N, E40D, K122E, D123S, S162SDGN, K166KR, K173IR, Q174K, T200TI, Q207A, L210LF, R211S, V245K, K249Q  
>SE_105| codons 1-253
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICNDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTRILEPFRRKNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRAHLFSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEQDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, R41K, H69K, L89M  
>SE_105| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012