<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE_74 SE_74 Sweden 2010 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39G, V60I, V90I, V118I, I135T, I142K, S162A, T165I, K173T, Q174S, T200E, Q207E, R211K, F214L, V245K  
>SE_74| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICGEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGKRYQYNVLPQGWKGSPAIFQASMIKILEPFRTSNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, Q18QL, K20IV, M36I, N37D, H69K, K70R, L89M  
>SE_74| codons 1-99
PQITLWQRPLVTVRIGELLVEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Karlsson, A Low prevalence of transmitted drug resistance in patients newly diagnosed with HIV-1 infection in Sweden 2003-2010. PLoS ONE, 2012