<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I E11D, I72V, L101I, K103R, S119G, T122I, T124A, T125A, T206S, K215Q, T218I, L234V, D256E  
>BR1070| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILRLAGRWPVKTIHTDNGGN
FISAAVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQQQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, M36I, P39S, L63P, I72V  
>BR1070| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEEINLSGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, I135T, S162C, D177N, G196D, V245M, T286A, I293V, P313T, V317A, G333E, Q334R, F346L, M357T, V435G, L469I, H483Y, K512Q I341T
>BR1070| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPNIVI
YQYMDDLYVGSDLEIDQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKETVHGAYYDPSKDLIAEIQKQERGQWTYQTYQEPLKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIGGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSITDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Sanabani, SS Characterization of partial and near full-length genomes of HIV-1 strains sampled from recently infected individuals in Sao Paulo, Brazil. PLoS ONE, 2011