<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LBJ10 LBJ10R_8 Denmark 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T+DDI+IDV+RTV+SQV NA
2 NVP+3TC+ABC+NFV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F   Y181C, Y188YFHL   K20R, K32N, V35I, T69N, K122E, I135K, S162Y, T200A, Q207E  
>LBJ10R_8| codons 1-215
PISPIETVPVKLKPGMDGPRVKQWPLTEEKINALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
CQYVDDLLVGSDLEIGQHRAKIEELREHLLRWGFF

References
Author Title Citation
Jorgensen, LB Genotypic and phenotypic nevirapine resistance correlates with virological failure during salvage therapy including abacavir and nevirapine. Antivir Ther, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005