<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I I13V, K14R, K20L, E35D, M36I, P39PT, R41K, L63P, H69K, K70KR, I72L, L89I R87RG
>SK6040-M24| codons 1-99
PQITLWQRPLVTVRIGGQLLEALLDTGADDTVIEDINLTGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRALGTVLVGPTPVNIIGGNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181YC   V35T, T39A, K122E, D123S, I135V, S162A, F171Y, K173T, Q174K, D177E, I178IM, T200AV, E203ED, E204EG, R211K, V245Q, K275Q, K277KR, T286A, E291D, V292I, I293V, P294T  
>SK6040-M24| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPYRTKNPEMVI
CQYMDDLYVGSDLEIGQHRVKIDGLRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Aghokeng, AF High failure rate of the ViroSeq HIV-1 genotyping system for drug resistance testing in Cameroon, a country with broad HIV-1 genetic diversity J Clin Microbiol, 2011