<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V   V106A F227FL K20KR, V35T, E40D, K49KR, K104R, K122E, D123S, S162A, K173KAET, Q174AE, D177E, T200A, I202IV, Q207E, R211K, F214L, V245Q, K275Q, K277R, T286A, E291D, V292I, I293V, P294T  
>SK3028-M24| codons 1-320
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSATVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14KR, L19K, K20I, M36I, R41N, H69K, L89M  
>SK3028-M24| codons 1-99
PQITLWQRPLVTARIGGQKIEALLDTGADDTVLEEINLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Aghokeng, AF High failure rate of the ViroSeq HIV-1 genotyping system for drug resistance testing in Cameroon, a country with broad HIV-1 genetic diversity J Clin Microbiol, 2011