<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SK1029-M24 SK1029-M24 Cameroon 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   K11A, V35T, T39R, K43E, D121Y, K122E, I142V, E169D, K173T, Q174K, D177E, I178L, G196E, T200A, E204Q, Q207A, R211S, V245Q, T286A, E291D, I293V, E312D  
>SK1029-M24| codons 1-320
PISPIETVPVALKPGMDGPKVKQWPLTEEKIKALTEICREMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRTKNPELVI
YQYVDDLYVGSDLEIEQHRAKIEQLRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKDPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20KR, E35D, M36I, N37E, R41RK, H69K, K70KR, I72IV, L89M  
>SK1029-M24| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIELPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Aghokeng, AF High failure rate of the ViroSeq HIV-1 genotyping system for drug resistance testing in Cameroon, a country with broad HIV-1 genetic diversity J Clin Microbiol, 2011