<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
219 CP001004 Central African Republic 2010 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74LI, M184V, L210LW, T215FY   K101E, G190A A98G L109I, V118VI, D121H, K122E, D123S, I142IT, S162D, E169EK, K173AT, Q174K, D177E, V179I, G196GS, I202IV, E203EK, Q207ADE, H208HY, R211RKNS, H221HY G45GR
>CP001004| codons 41-240
LEKERKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGL
EKKKSVTVIDVGDAYFSIPLHESFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIF
QDSMTKILKPFRTKNPEIIIYQYVDDLYVASDLEISQHRTKVKELREYLWSWGFYTPDKK
YQKEPPFLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, K45R, I62V, L63P, G68E, H69R, L89M  
>CP001004| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QVPIEICERKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011