<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, Y181YC V108VI, Y318YF E6DN, K11T, V35T, T39K, T69TN, K122E, D123G, I135IT, K173IM, Q174K, D177E, Q197L, T200E, I202V, Q207A, R211K, V245Q, A272P, K275Q, K277R, I293V, E312N Q182QH
>CP 001 146| codons 1-334
PISPINTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRMKNPEIVI
CHYVDDLYVGSDLEIGLHREKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKNPVHGVFYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G48GE I13V, K14R, I15V, G16E, E35D, M36I, N37D, P39PL, R41K, K43KI, L63LV, H69K, I72IR, L89M D29DE, G40GR, G51GR
>CP 001 146| codons 1-99
PQITLWQRPLVTVRVEGQLKEALLDTGAEDTVLEDIDLLRKWIPKMIEGIRGFIKVRQYD
QIVIEICGKKARGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011