<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, V75I, F116Y Y181C A98G I31L, V35T, T39R, K43E, S68SG, D121H, K122E, I135IT, I142V, K173A, Q174K, D177E, G196GE, T200A, Q207A, R211S, K238R, V245E, A272P, K281R, E291D, I293V, E312N, D324E N81ND
>CP 001 724| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTEICREMEEEGKISKIGPENPYNTPV
FVIKKKDGTKWRKLIDFRELDKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYYSVPL
HEDFRKYTAFTIPSTNNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRAKNPEIVI
CQYVDDLYVGSDLEIEQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTDVVPLTEEAE
LELAENREILKNPVHGVYYDPSKELIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, K20R, E35D, M36I, N37D, R41K, R57K, Y59YH, L63A, H69K, K70R, L89M  
>CP 001 724| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQHD
QIAIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011