<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, L74LV, M184V   K103N, Y181YC, G190GA   I5IV, E6ED, K20KR, V35T, T39X, K49KR, K102KN, K122E, D123N, I135IATV, I142IT, S162SG, T165TILP, K173AT, Q174QK, D177E, I178IL, Q197QE, T200TAEK, I202IV, Q207X, R211K, H221HY, V245KQ, E248EDKN, S251SC, A272AP, Q278QE, L283I, E291ED, V292VI, I293V, E297EGKR, R307RK, E312ED, S322SA I329IMV
>CP 001 630| codons 1-333
PISPVDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICXEMEKEGKISRIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKNNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGTRYQYNVLPQGWKGSPAIFQGSMPKILEPFRTKNPELVI
CQYVDDLYVASDLEIGEHRKKVEELRXHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPNKDCWTVNDIQKLVGKLNWASQIYPGIKVKELCKLIRGTKALTDIVPLTREAE
LELAENKEILKDPVHGVYYDPAKDLIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LV, T12TA, I13IMV, K14KR, I15IV, G16AE, E35D, M36I, N37D, R41K, D60DE, Q61QEGR, L63X, C67CDGY, H69K, K70KR, I72IATV, L89M  
>CP 001 630| codons 1-99
PQITLWQRPVVAVRVEGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYE
RIXIEIYGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011