<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184MV K219KN K103KN, Y181C A98AG K11ST, V35T, T39N, K102KR, D121H, K122E, D123S, T139TK, K173S, D177DE, G196E, T200A, Q207A, R211S, H221HY, V245Q, K277R, Q278H, K281R, T286A, E291D, I293V, E312DN, G333GE  
>CP 001 2151| codons 1-334
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKRNKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIVI
CQYVDDLYVGSDLEIEQHRAKIEELRAHLLSWGFTTPDNKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCRLLRGAKALTDVVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEIQKQEQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, M36I, R41K, L63T, H69K, K70R, I72T, L89M  
>CP 001 2151| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKRATGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011