<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181YC, G190GA A98AG K11T, V35VI, D121H, K122E, D123G, I135IT, I142V, K173S, Q174QK, D177DE, V179I, G196E, T200A, Q207A, F214FL, H221HY, V245KQ, E248ED, D250DE, A272P, E291D, V292I, I293IV, E297A  
>CP 001 980| codons 1-333
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
HEGFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
CQYVDDLYVASDLEIEQHRAKIEELRAHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, G16A, M36I, N37D, D60E, Q61E, L63A, C67E, H69K, V77I  
>CP 001 980| codons 1-99
PQITLWQRPVVTIKVAGQLKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYE
EIAIEIEGKKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011