<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+AZT+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, E34K, M36I, N37D, L63T, I64M, H69K, K70KR, I72T, L89M P39M
>CP 001-144| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLKEIDLMGRWKPKMIGGIGGFIKVRQYD
QITMEICGKRATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   K103KN, Y181YC, G190GA   V35T, T39N, K49R, V60I, V90VI, K122E, D123N, I135T, T139KR, I142V, S162H, K173S, Q174K, V179VI, T200TA, Q207EK, R211KN, V245E, T286A, I293V, E297T, E312N  
>CP 001-144| codons 1-332
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNERPGVRYQYNVLPQGWKGSPAIFQHSMTKILEPFRSKNPDIII
CQYVDDLYVASDLEIGQHRAKIEELRKHLLNWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTTEAE
LELAENREILKNPVHGVYYDPSKDLIAEIQKQ

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011