<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 CP 001-259 Central African Republic 2010 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+D4T+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, K14KR, E35D, M36I, R41K, I62IV, L63AV, I64IL, H69K, K70KR, I72IV, L89M  
>CP 001-259| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVVLEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN, Y188Y*FL V179VD K11T, K20R, V35T, T39TKN, K102KR, D121H, K122E, I135M, I142V, S162H, K173ST, Q174K, D177E, G196E, T200I, Q207A, R211S, P243S, V245Q, A272P, K281R, T286A, E291D, I293V  
>CP 001-259| codons 1-333
PISPIETVPVTLKPGMDGPRVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGVRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTKNPEIDI
YQYVDDLLVGSDLEIEQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011