<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+AZT+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L33I L10V, I13V, L19F, K20T, E35D, M36I, R41K, R57K, L63P, H69K, T74S, L89I  
>CP 001-045| codons 1-99
PQITLWQRPVVTVKIGGQFTEALLDTGADDTVIEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGKKAIGSVLVGPTPVNIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV, T215Y V75I Y181C   V8I, K11T, V35T, T39KR, K43E, T69S, K101R, D121H, K122E, D123S, I132L, K173A, Q174K, V179I, E194D, G196GE, Q207A, R211S, H221Y, V245E, R284RK, T286A, A288T, E291D, V292I, I293V, P294T, E312T, I326V  
>CP 001-045| codons 1-334
PISPIETIPVTLKPGMDGPKVKQWPLTEEKIKALTEICRELEEEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIII
CQYVDDLYVGSDLDIEQHRTKIEELRAHLLSWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKTLTDIVTLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEIQKQGQ

References
Author Title Citation
Charpentier, C Virological response and resistance profiles after 18 to 30 months of first- or second-/third-line antiretroviral treatment: A cross-sectional evaluation in HIV type 1-infected children living in the Central African Republic. ARHR, 2011