<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-2 CB-2 Italy 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 12
2 DDI 74
3 3TC+AZT 60
4 D4T+DDC+IDV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M V75I, F77L, F116Y     V35I, S68G, R83K, D123E, K166R, D177E, G196E, R211K  
>CB-2| codons 32-218
KALIEICTEMEKEGKISKIGPENPYNTPVFAIKRKDGTRWRKLIDLRELNKKTQDFWEVQ
LGIPHPAGLKKKKSVTVLDVGDAYYSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPM
GWKGSPAIFQSSMTRILEPFRKQNPEIVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLLK
WGFTTPD

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005