<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-1 CB-1 Italy 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 43
2 3TC+AZT 17
3 3TC+D4T+IDV 47
4 3TC+D4T+RTV+SQV 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, V75I, F77L, F116Y, K219Q     E40K, K43N, I50IF, E53D, S68G, T107TP, V118I, D121H, K122E, I178L, T200A, I202V, R211T, F214L W24WG
>CB-1| codons 1-242
PISPIETVPVKLKPGMDGPKVKQGPLTEEKIKALVEICTKMENEGKISKFGPDNPYNTPV
FVIKKKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVPVLDVGDAYYSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRAKVEELRQHLLTWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005