<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-314 CB-314 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| IDV| RTV| NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y A62V K103N, Y181C   T7P, P14PS, K43E, E44A, K66KR, T69TI, D123E, D177E, H208Y, R211K, K223KE, L228R  
>CB-314| codons 1-253
PISPIEPVPVKLKSGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FVIKKRDSIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQEEPPFRWMGYELHPDKWT
VQPIVLPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V L10F I15V, K20R, M36I, D60E, I62IV, L63P  
>CB-314| codons 1-99
PQITLWQRPFVTIKVGGQLREALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYE
QVPIEICGHKAIGTVLVGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005