<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-300 CB-300 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| D4T| IDV| RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MV, T215TFIS K219Q     V35E, T39A, V60I, V90I, K104KR, D123E, I135R, I142K, S162Y, G196E  
>CB-300| codons 1-233
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSRNNETPGKRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFSTPDQKHQKEPPFLWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I62V, L63P, I64V, H69N, T96TS  
>CB-300| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGNKAIGTVLVGPTPVNIIGRNLLTQIGCSLNF

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005