<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-297 CB-297 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| IDV| NFV| RTV| SQV| EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   G190S   S48A, T69H, K102E, K122E, R211K S68Q, P133PR, D185DE
>CB-297| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKIAKIGPENPYNTPV
FAIKKKDQHKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKEKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIRSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMEDLYVSSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
V

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, K20R, E35D, M36I, R41K, L63P, H69K, A71V A28AV
>CB-297| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGVDDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGKKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005