<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-296 CB-296 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| D4T| IDV| NFV| RTV| SQV| EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73T L10I, L63P K20K*LM, G52GS
>CB-296| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGSFIKVRQYD
QIPIEICGHKAITTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y D67G L100LI, K103N   V35VI, V60I, K64KR, T69TI, R83K, K122E, I135L, K173KR, D177E, I178M, R211K L80LF
>CB-296| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPI
FAIRKKGSIKWRKVVDFREFNKKTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
V

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005