<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-285 CB-285 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| IDV| NFV| RTV| SQV| NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, I15V, E35D, M36V, N37E, D60E, I62V, L63P, A71V, I72M, V77I, I85V  
>CB-285| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDVELPGRWKPKMIGGIGGFIKVRQYE
QVPIEICGHKVMSTVLIGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   Y181YC, G190GA   K20KR, T107TP, V118I, D123A, E203K, Q207E, H208Y, R211K, K223Q N81NT, E89EK
>CB-285| codons 1-250
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELTKRTQDFWKVQLGIPHPAGLKKKKSVPVLDVGDAYFSIPL
DKAFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIKELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005