<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-246 CB-246 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| ABC| IDV| NFV| RTV| SQV| NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q K103N, Y181C   V35I, E36EK, T39A, S48E, R83K, D123E, I135T, Q174H, G196E, T200A, Q207K, R211T, F214L, V245E  
>CB-246| codons 1-245
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIKICAEMEKEGKIEKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
CQYMDDLYVGSDLEIEQHRAKIEELRKHLLTWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I15V, L19Q, K20I, M36I, N37ND, L63P, H69K, A71V, I93L  
>CB-246| codons 1-99
PQITLWQRPLVSIKVGGQQIEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005