Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CB-235 | CB-235 | Italy | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT| 3TC| DDC| D4T| IDV | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54V, V82A | L24I | L10I, R41K, R57K, Q61E, L63P, H69Y, A71T, I72IT |
| >CB-235| codons 1-99 PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVKVKQYD EIPIEICGYKTTGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Balotta, C | Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. | JAIDS, 2000 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |