<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-231 CB-231 Italy 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDC| IDV| SQV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219Q     V35T, E40D, T69N, D123E, I135L, S162W, K166R, K173A, Q174K, V179I, T200A, Q207G, R211K, V245Q  
>CB-231| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQWSMTRILEPFRAKNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, T12N, I15V, K20R, E35D, M36I, R41K, K43I, R57K, Q61N, L63C  
>CB-231| codons 1-99
PQITLWQRPIVNIKVGGQLREALLDTGADDTVLEDINLPGKWIPKMIVGIGGFVKVKQYD
NICIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000