<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-210 CB-210 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDC| D4T| RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215V, K219Q     T69N, V90I, D123E, T139TA, I180V D110DN, E138CY, G141R
>CB-210| codons 1-245
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLNVGDAYFSVPL
DKEFRKYTAFTIPSINNCAPRIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVV
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   M36I, Q61H, L63T, H69K, I72T  
>CB-210| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
HITIEICGKKATGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005