<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4H, V21I, V35T, T39G, K49R, I135T, S162C, R172K, D177E, I178L, E204N, Q207E, R211K, F214L, V245T, E248N, K249Q, D250E, A272P, K277R, T286A, E297K, G333E, Q334A, G335C, Y339W, R356K, M357V, Q373H, K374R, K390R, T403K, K431T, V435I Q182S
>cm182bb| codons 1-438
PISHIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICGEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFKKQNPELVI
YSYMDDLYVGSDLEIGQHRTKIENLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPNQESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEACQWTWQIYQEPFKNLKTGKYAKVRGA
HTNDVKQLTEAVHRIATESIVIWGKTPKFRLPIQKETWEAWWKEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIIGAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  Q58E E35D, M36I, R41K, L63P, H69K, V77I  
>cm182bb| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVREYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Youngpairoj, AS Prevalence of drug resistance-related polymorphisms in treatment-naive individuals infected with nonsubtype B HIV type 1 in Cameroon. ARHR, 2012