<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Irkutsk_5 Irkutsk_5 Russia 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    R20K, V32I, D41N, Q44H, I72V, L74I, T112V, I113V, S119P, T124S, T125A, G134D, K136Q, K156R, D167E, V201I, T218I, L234I, S255N  
>Irkutsk_5| codons 1-288
FLDGIDKAQEEHEKYHSNWKAMASDFNLPPVIAKEIVASCNKCHLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGPN
FTSSAVKAACWWADIQQEFGIPYNPQSQGVVESMNRELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, L63P, H69K, V77I, L89M, I93L  
>Irkutsk_5| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Fernandez-Garcia, A The analysis of near full-length genome sequences of HIV-1 subtype A viruses from Russia supports the monophyly of major intrasubtype clusters. ARHR, 2012