<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-187 CB-187 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| IDV| RTV| SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, G17D, E34Q, M36L, L38W, I62V, L63P, A71V, I72Q, I93L, T96TS  
>CB-187| codons 1-99
PQITLWQRPIVTIKIGDQLKEALLDTGADDTVLQELNWPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVQGTVLVGPTPANIIGRNLMTQLGCSLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y A62V     T27TA, K43Q, E44D, K49R, V118I, K122E, E138A, S162C, Q174N, I178F, H208Y, R211K, L228H  
>CB-187| codons 1-245
PISPIETVPVKLKPGMDGPKVKQWPLAEEKIKALVEICTELEQDGKISRIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKNNPDFVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIV

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005