Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CB-184 | CB-184 | Italy | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT| 3TC| DDI| DDC| D4T| IDV| NFV| RTV| SQV | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V, I54T, V82A, L90M | L10I, K20KR, E34EQ, E35D, M36I, N37ND, L63P, I64V, A71V, I93L | G51G* |
| >CB-184| codons 1-99 PQITLWQRPIVTIKIGGQLREALLDTGADDTVLQDIDLPGRWKPKMIVGI*GFTKVRQYD QIPVEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Balotta, C | Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. | JAIDS, 2000 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
