<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+LPV 84

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181YC   T27TS, V35T, E36A, T39E, E40D, K101R, K122E, D123N, I135T, T139A, D177E, T200A, Q207E, F214L, P243T, V245Q, A272S, T286A, E291D, V292I, I293V, P294T, D324E  
>707PKE40F| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTAICEDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TS, I15V, L19IT, M36I, R41K, L63HP, H69K, L89LM, I93L  
>707PKE40F| codons 1-99
PQITLWQRPLVSIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Green, TN Drug resistance and coreceptor usage in HIV type 1 subtype C-infected children initiating or failing highly active antiretroviral therapy in south Africa. ARHR, 2011