<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 131

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67G, V75I, K219Q V106M, Y181C F227L K20KR, V35T, T39E, S48T, V60I, K101KI, K122E, D123N, I132L, I135V, K173A, Q174K, D177E, T200E, E203K, Q207E, R211K, F214L, V245Q, A272P, K277R, E291D, V292I, I293V  
>707PKE39F| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKGSTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLIKKKSMTVLDVGDAYFSVPL
DENFRKYTAFTLPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
CQYVDDLYVGSDLEIGQHREKIKELREHLLKWGLTTPDQKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12TA, I15IV, L19V, M36I, R41K, L63V, H69K, T74S, L89M, I93L  
>707PKE39F| codons 1-99
PQITLWQRPVVAIKVGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Green, TN Drug resistance and coreceptor usage in HIV type 1 subtype C-infected children initiating or failing highly active antiretroviral therapy in south Africa. ARHR, 2011