<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 189

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, M184V, T215Y F77L, K219E V106M, G190A F227L V35T, E36A, T39E, S48T, V60I, T69TN, A98S, L109I, K122E, D123S, I135T, S163T, K173A, Q174K, D177E, T200A, Q207E, R211K, D218E, L228H, P243T, V245Q, A272P, T286A, E291D, V292I, I329IV  
>707PKE27F| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEELEKEGKITKIGPENPYNTPI
FAIKKKNSNRWRKLMDLRELNKRTQDFWEVQLGIPHPSGLKKKKSMTVIDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRAKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFYTPEEKHQKEPPLHWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19T, K20R, M36I, R41K, L63LP, H69K, L89M, I93L  
>707PKE27F| codons 1-99
PQITLWQRPLVSIKIGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Green, TN Drug resistance and coreceptor usage in HIV type 1 subtype C-infected children initiating or failing highly active antiretroviral therapy in south Africa. ARHR, 2011